PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 250aa    MW: 28566.1 Da    PI: 7.5595
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-29034PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-18541001056
                HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                eql++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Vun008880  54 EQLKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 100
                8*********************************************9 PP

2HD-ZIP_I/II122.12.7e-3954136991
  HD-ZIP_I/II   9 eqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  eq+k+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+y+a+k++n++L++++++L++e+
    Vun008880  54 EQLKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYEAIKADNDALQAQNQKLQTEI 136
                  9*******************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-1932104IPR009057Homeodomain-like
PROSITE profilePS5007116.09942102IPR001356Homeobox domain
SMARTSM003891.3E-1744106IPR001356Homeobox domain
PfamPF000461.3E-1554100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.0E-2054109IPR009057Homeodomain-like
CDDcd000862.07E-1454103No hitNo description
PRINTSPR000319.1E-67382IPR000047Helix-turn-helix motif
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PRINTSPR000319.1E-68298IPR000047Helix-turn-helix motif
PfamPF021839.2E-16102142IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MAFFPANFML QTPHQDDHQP PPSLNSIITS CAPQEYHGGA SFLGKRSMSF SGIEQLKTLE  60
KSFELGNKLE PERKMQLARA LGLQPRQIAI WFQNRRARWK TKQLEKDYDL LKRQYEAIKA  120
DNDALQAQNQ KLQTEILALK SREPTESINL NKETEGSSSN RSENSSEIKL DISRTPAIDS  180
PLSTQQNSRN LFPSSTRPTG VAQLFQTTSR PELQCQKIDH MVKEESLSNM FCGIDDQSGL  240
WPWLEQQHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194102RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014510478.11e-170PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC034e-96ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLV7C9651e-170V7C965_PHAVU; Uncharacterized protein
STRINGGLYMA18G15970.11e-166(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.18e-86HD-ZIP family protein